SCOPe 2.08: Domain d5n95a1: 5n95 A:1-470

Lineage for d5n95a1 (5n95 A:1-470)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.0: automated matches [227142] (1 protein)
   not a true family

6. Protein automated matches [226844] (11 species)
   not a true protein

7. Species Foot-and-mouth disease virus [TaxId:12110] [346409] (2 PDB entries)

8. Domain d5n95a1: 5n95 A:1-470 [345807]
   Other proteins in same PDB: d5n95a2
   automated match to d5xe0a_
   complexed with 3po; mutant

Details for d5n95a1

PDB Entry: 5n95, 2.6 Å

PDB Description: tetragonal structure of mutant v173i of 3d polymerase from foot-and- mouth disease virus

PDB Compounds: (A:) 3D polymerase

SCOPe Domain Sequences for d5n95a1:

Sequence; same for both SEQRES and ATOM records:

>d5n95a1 e.8.1.0 (A:1-470) automated matches {Foot-and-mouth disease virus [TaxId: 12110]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekiragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda

Timeline for d5n95a1:

• d5n95a1 first appeared in SCOPe 2.07