Lineage for d1frwa_ (1frw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898731Family c.68.1.8: Molybdenum cofactor biosynthesis protein MobA [53470] (1 protein)
    automatically mapped to Pfam PF12804
  6. 2898732Protein Molybdenum cofactor biosynthesis protein MobA [53471] (2 species)
  7. 2898735Species Escherichia coli [TaxId:562] [53472] (8 PDB entries)
  8. 2898738Domain d1frwa_: 1frw A: [34580]
    complexed with act, gtp, mn, zn

Details for d1frwa_

PDB Entry: 1frw (more details), 1.75 Å

PDB Description: structure of e. coli moba with bound gtp and manganese
PDB Compounds: (A:) molybdopterin-guanine dinucleotide biosynthesis protein

SCOPe Domain Sequences for d1frwa_:

Sequence, based on SEQRES records: (download)

>d1frwa_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]}
nlmttitgvvlaggkarrmggvdkgllelngkplwqhvadalmtqlshvvvnanrhqeiy
qasglkviedsladypgplagmlsvmqqeagewflfcpcdtpyippdlaarlnhqrkdap
vvwvhdgerdhptialvnraiepllleylqagerrvmvfmrlagghavdfsdhkdafvnv
ntpeelarwqe

Sequence, based on observed residues (ATOM records): (download)

>d1frwa_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]}
nlmttitgvvlaggkvdkgllelngkplwqhvadalmtqlshvvvnanrhqeiyqasglk
viedsladypgplagmlsvmqqeagewflfcpcdtpyippdlaarlnhqrkdapvvwvhd
gerdhptialvnraiepllleylqagerrvmvfmrlagghavdfsdhkdafvnvntpeel
arwqe

SCOPe Domain Coordinates for d1frwa_:

Click to download the PDB-style file with coordinates for d1frwa_.
(The format of our PDB-style files is described here.)

Timeline for d1frwa_: