Lineage for d5ltvc_ (5ltv C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970927Superfamily d.110.6: Sensory domain-like [103190] (5 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 2971038Family d.110.6.0: automated matches [345975] (1 protein)
    not a true family
  6. 2971039Protein automated matches [346107] (2 species)
    not a true protein
  7. 2971040Species Pseudomonas aeruginosa [TaxId:287] [346382] (2 PDB entries)
  8. 2971043Domain d5ltvc_: 5ltv C: [345793]
    automated match to d5t65a_
    complexed with abu, act, gol, so4

Details for d5ltvc_

PDB Entry: 5ltv (more details), 2.31 Å

PDB Description: ligand binding domain of pseudomonas aeruginosa pao1 amino acid chemorecpetor pctc in complex with gaba
PDB Compounds: (C:) Chemotactic transducer PctC

SCOPe Domain Sequences for d5ltvc_:

Sequence, based on SEQRES records: (download)

>d5ltvc_ d.110.6.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dtenylgeigtltasniqswlegrmhlveglasqlalldqpdeaniarqleqpvfsrnfa
svylgeaasgtftmrpydampegydprtrawykdalaadrlivtepfvdagtgeqilams
lpvrhagqllgvaagdmkletltailnslkfdgagyaflvsdagkillhpdsglvlktla
eaypkgapnivpgvheveldgssqfvsftpvkglpgvtwyvalvl

Sequence, based on observed residues (ATOM records): (download)

>d5ltvc_ d.110.6.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dtenylgeigtltasniqswlegrmhlveglasqlalldqpdeaniarqleqpvfsrnfa
svylgeaasgtftmrpydampegydprtrawykdalaadrlivtepfvdagtgeqilams
lpvrhagqllgvaagdmkletltailnslkfdgagyaflvsdagkillhpdsglvlktla
eaypkgapnivpgvhevelssqfvsftpvkglpgvtwyvalvl

SCOPe Domain Coordinates for d5ltvc_:

Click to download the PDB-style file with coordinates for d5ltvc_.
(The format of our PDB-style files is described here.)

Timeline for d5ltvc_: