![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
![]() | Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
![]() | Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
![]() | Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
![]() | Protein automated matches [226934] (28 species) not a true protein |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321813] (4 PDB entries) |
![]() | Domain d5k3hc1: 5k3h C:2-281 [345732] Other proteins in same PDB: d5k3ha2, d5k3ha3, d5k3hb2, d5k3hb3, d5k3hc2, d5k3hc3, d5k3hd2, d5k3hd3, d5k3he2, d5k3he3, d5k3hf2, d5k3hf3, d5k3hg2, d5k3hg3, d5k3hh2, d5k3hh3 automated match to d5k3ic1 |
PDB Entry: 5k3h (more details), 2.48 Å
SCOPe Domain Sequences for d5k3hc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k3hc1 e.6.1.0 (C:2-281) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp kmaynivdngflgfnnyriprtnllmrhtkveadgtyikp
Timeline for d5k3hc1: