Lineage for d5k3hc1 (5k3h C:2-281)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570412Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2570413Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2570558Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2570559Protein automated matches [226934] (28 species)
    not a true protein
  7. 2570684Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321813] (4 PDB entries)
  8. 2570687Domain d5k3hc1: 5k3h C:2-281 [345732]
    Other proteins in same PDB: d5k3ha2, d5k3ha3, d5k3hb2, d5k3hb3, d5k3hc2, d5k3hc3, d5k3hd2, d5k3hd3, d5k3he2, d5k3he3, d5k3hf2, d5k3hf3, d5k3hg2, d5k3hg3, d5k3hh2, d5k3hh3
    automated match to d5k3ic1

Details for d5k3hc1

PDB Entry: 5k3h (more details), 2.48 Å

PDB Description: crystals structure of acyl-coa oxidase-1 in caenorhabditis elegans, apo form-ii
PDB Compounds: (C:) Acyl-coenzyme A oxidase

SCOPe Domain Sequences for d5k3hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k3hc1 e.6.1.0 (C:2-281) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
kmaynivdngflgfnnyriprtnllmrhtkveadgtyikp

SCOPe Domain Coordinates for d5k3hc1:

Click to download the PDB-style file with coordinates for d5k3hc1.
(The format of our PDB-style files is described here.)

Timeline for d5k3hc1:

  • d5k3hc1 is new in SCOPe 2.07-stable