Lineage for d5k0tc2 (5k0t C:353-510)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316215Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2316216Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2316269Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2316270Protein automated matches [226872] (13 species)
    not a true protein
  7. 2316283Species Brucella suis [TaxId:204722] [346172] (2 PDB entries)
  8. 2316289Domain d5k0tc2: 5k0t C:353-510 [345720]
    Other proteins in same PDB: d5k0ta1, d5k0tb1, d5k0tc1
    automated match to d2x1la2
    protein/RNA complex; complexed with 415, edo

Details for d5k0tc2

PDB Entry: 5k0t (more details), 2.6 Å

PDB Description: crystal structure of methionyl-trna synthetase metrs from brucella melitensis in complex with inhibitor chem 1415
PDB Compounds: (C:) Methionine--tRNA ligase

SCOPe Domain Sequences for d5k0tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k0tc2 a.27.1.0 (C:353-510) automated matches {Brucella suis [TaxId: 204722]}
andlgnlaqrslsmiakncegkvpqpgafseadkaildqadaaletarkamddqalhlal
gaifavvaeanryfagqepwalrktdparmgtvlyvtaevlrrvgimvqpfipqsaekll
dilavpadkrqfadvlasplaggtdlpapqpvfpryve

SCOPe Domain Coordinates for d5k0tc2:

Click to download the PDB-style file with coordinates for d5k0tc2.
(The format of our PDB-style files is described here.)

Timeline for d5k0tc2:

  • d5k0tc2 is new in SCOPe 2.07-stable