Lineage for d1g23e_ (1g23 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898466Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 2898485Protein RmlA (RfbA) [53465] (5 species)
  7. 2898521Species Pseudomonas aeruginosa [TaxId:287] [53466] (9 PDB entries)
  8. 2898566Domain d1g23e_: 1g23 E: [34572]
    complexed with g1p, so4

Details for d1g23e_

PDB Entry: 1g23 (more details), 2.8 Å

PDB Description: the structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). glucose-1-phosphate complex.
PDB Compounds: (E:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d1g23e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g23e_ c.68.1.6 (E:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]}
krkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdtp
rfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhel
lgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydqq
vvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfiat
lenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy

SCOPe Domain Coordinates for d1g23e_:

Click to download the PDB-style file with coordinates for d1g23e_.
(The format of our PDB-style files is described here.)

Timeline for d1g23e_: