SCOPe 2.08: Domain d5k0ta2: 5k0t A:353-508

Lineage for d5k0ta2 (5k0t A:353-508)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (13 species)
   not a true protein

7. Species Brucella suis [TaxId:204722] [346172] (2 PDB entries)

8. Domain d5k0ta2: 5k0t A:353-508 [345716]
   Other proteins in same PDB: d5k0ta1, d5k0tb1, d5k0tc1
   automated match to d2x1la2
   protein/RNA complex; complexed with 415, edo

Details for d5k0ta2

PDB Entry: 5k0t, 2.6 Å

PDB Description: crystal structure of methionyl-trna synthetase metrs from brucella melitensis in complex with inhibitor chem 1415

PDB Compounds: (A:) Methionine--tRNA ligase

SCOPe Domain Sequences for d5k0ta2:

Sequence; same for both SEQRES and ATOM records:

>d5k0ta2 a.27.1.0 (A:353-508) automated matches {Brucella suis [TaxId: 204722]}
andlgnlaqrslsmiakncegkvpqpgafseadkaildqadaaletarkamddqalhlal
gaifavvaeanryfagqepwalrktdparmgtvlyvtaevlrrvgimvqpfipqsaekll
dilavpadkrqfadvlasplaggtdlpapqpvfpry

Timeline for d5k0ta2:

• d5k0ta2 first appeared in SCOPe 2.07