Lineage for d5k0sc1 (5k0s C:3-352)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (52 species)
    not a true protein
  7. 2443190Species Brucella suis [TaxId:204722] [346284] (2 PDB entries)
  8. 2443193Domain d5k0sc1: 5k0s C:3-352 [345713]
    Other proteins in same PDB: d5k0sa2, d5k0sb2, d5k0sc2
    automated match to d2x1la1
    protein/RNA complex; complexed with 0ou

Details for d5k0sc1

PDB Entry: 5k0s (more details), 2.45 Å

PDB Description: crystal structure of methionyl-trna synthetase metrs from brucella melitensis in complex with inhibitor chem 1312
PDB Compounds: (C:) Methionine--tRNA ligase

SCOPe Domain Sequences for d5k0sc1:

Sequence, based on SEQRES records: (download)

>d5k0sc1 c.26.1.0 (C:3-352) automated matches {Brucella suis [TaxId: 204722]}
rekyyittaiaypngkphighayeliatdamarfqrlngmdvyfltgtdehgikmlqsar
kegitprdladrntsafrrmaevlnssnddyirtseerhykasqaiwqamvangdiykgg
yagwysvrdeayygeeetevradgvrygpqgtpvewveeesyffrlsayqdklldlyenn
pgfimpaerrneivsfvksglkdlsisrttfdwgipvpgdekhvmyvwvdaltnyitalg
ypdttderwaywpanahiigkdisrfhavywpaflmsaqlplpkrvfahgflfnrgekms
ksvgnvidpfelverygldqlryflmrevpfgqdgsysheaivnrtnadl

Sequence, based on observed residues (ATOM records): (download)

>d5k0sc1 c.26.1.0 (C:3-352) automated matches {Brucella suis [TaxId: 204722]}
rekyyittaiaypngkphighayeliatdamarfqrlngmdvyfltgtdehgikmlqsar
kegitprdladrntsafrrmaevlnssnddyirtseerhykasqaiwqamvangdiykgg
yagwysvrdeayygeeetevradgvrygpqgtpvewveeesyffrlsayqdklldlyenn
pgfimpaerrneivsfvksglkdlsisrttfdwgipvpgdekhvmyvwvdaltnyitalg
ypdttderwaywpanahiigkdisrfhavywpaflmsaqlplpkrvfahgflfnridpfe
lverygldqlryflmrevpfgqdgsysheaivnrtnadl

SCOPe Domain Coordinates for d5k0sc1:

Click to download the PDB-style file with coordinates for d5k0sc1.
(The format of our PDB-style files is described here.)

Timeline for d5k0sc1:

  • d5k0sc1 is new in SCOPe 2.07-stable