SCOPe 2.07: Domain d5k0sb2: 5k0s B:353-510

Lineage for d5k0sb2 (5k0s B:353-510)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (13 species)
   not a true protein

7. Species Brucella suis [TaxId:204722] [346172] (2 PDB entries)

8. Domain d5k0sb2: 5k0s B:353-510 [345712]
   Other proteins in same PDB: d5k0sa1, d5k0sb1, d5k0sc1
   automated match to d2x1la2
   protein/RNA complex; complexed with 0ou

Details for d5k0sb2

PDB Entry: 5k0s, 2.45 Å

PDB Description: crystal structure of methionyl-trna synthetase metrs from brucella melitensis in complex with inhibitor chem 1312

PDB Compounds: (B:) Methionine--tRNA ligase

SCOPe Domain Sequences for d5k0sb2:

Sequence; same for both SEQRES and ATOM records:

>d5k0sb2 a.27.1.0 (B:353-510) automated matches {Brucella suis [TaxId: 204722]}
andlgnlaqrslsmiakncegkvpqpgafseadkaildqadaaletarkamddqalhlal
gaifavvaeanryfagqepwalrktdparmgtvlyvtaevlrrvgimvqpfipqsaekll
dilavpadkrqfadvlasplaggtdlpapqpvfpryve

Timeline for d5k0sb2:

• d5k0sb2 is new in SCOPe 2.07-stable
  
• d5k0sb2 appears in the current release, SCOPe 2.08