Class a: All alpha proteins [46456] (289 folds) |
Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily) dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices |
Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) |
Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins) Pfam PF03271 |
Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [140615] (12 PDB entries) Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254 |
Domain d5jx1a_: 5jx1 A: [345708] automated match to d5jv3b_ |
PDB Entry: 5jx1 (more details), 1.67 Å
SCOPe Domain Sequences for d5jx1a_:
Sequence, based on SEQRES records: (download)
>d5jx1a_ a.245.1.1 (A:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]} dpkdallrqfqkeieelkkkleelekerdfyfgklrnielicqenegendpvlqrivdil yatdegfvip
>d5jx1a_ a.245.1.1 (A:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]} dpkdallrqfqkeieelkkkleelekerdfyfgklrnielicqdpvlqrivdilyatdeg fvip
Timeline for d5jx1a_: