SCOPe 2.08: Domain d5jvpf1: 5jvp F:3-89

Lineage for d5jvpf1 (5jvp F:3-89)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
   dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices

4. Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family)

5. Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
   Pfam PF03271

6. Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140615] (14 PDB entries)
   Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254

8. Domain d5jvpf1: 5jvp F:3-89 [345706]
   Other proteins in same PDB: d5jvpf2
   automated match to d5jv3b_
   complexed with cd

Details for d5jvpf1

PDB Entry: 5jvp, 2.1 Å

PDB Description: the neck-linker and alpha 7 helix of homo sapiens cenp-e

PDB Compounds: (F:) Chimera protein of Centromere-associated protein E and Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d5jvpf1:

Sequence, based on SEQRES records:

>d5jvpf1 a.245.1.1 (F:3-89) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
nevstdeallkryrkeimdlkkqleevsletraqamekdqlekerdfyfgklrnielicq
enegendpvlqrivdilyatdegfvip

Sequence, based on observed residues (ATOM records):

>d5jvpf1 a.245.1.1 (F:3-89) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
nevstdeallkryrkeimdlkkqleevsletraqamekdqlekerdfyfgklrnielicq
edpvlqrivdilyatdegfvip

Timeline for d5jvpf1:

• d5jvpf1 first appeared in SCOPe 2.07