SCOPe 2.08: Domain d5joea1: 5joe A:1-90

Lineage for d5joea1 (5joe A:1-90)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5joea1: 5joe A:1-90 [345693]
   Other proteins in same PDB: d5joea2
   automated match to d5jdjo_
   complexed with edo, ipa

Details for d5joea1

PDB Entry: 5joe, 2 Å

PDB Description: crystal structure of i81 from titin

PDB Compounds: (A:) titin

SCOPe Domain Sequences for d5joea1:

Sequence; same for both SEQRES and ATOM records:

>d5joea1 b.1.1.0 (A:1-90) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvtlikdienqtvlkdndavfeidikinypeiklswykgteklepsdkfeisidgdrhtl
rvkncqlkdqgnyrlvcgphiasakltvie

Timeline for d5joea1:

• d5joea1 first appeared in SCOPe 2.07, called d5joea_