Lineage for d5ja1b_ (5ja1 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2573862Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2573926Superfamily d.100.2: MbtH-like [160582] (2 families) (S)
    the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position
  5. 2573936Family d.100.2.0: automated matches [254253] (1 protein)
    not a true family
  6. 2573937Protein automated matches [254578] (8 species)
    not a true protein
  7. 2573940Species Escherichia coli [TaxId:83333] [346372] (1 PDB entry)
  8. 2573941Domain d5ja1b_: 5ja1 B: [345692]
    automated match to d5u89b_
    complexed with 75c, cl

Details for d5ja1b_

PDB Entry: 5ja1 (more details), 3 Å

PDB Description: entf, a terminal nonribosomal peptide synthetase module bound to the mbth-like protein ybdz
PDB Compounds: (B:) Enterobactin biosynthesis protein YbdZ

SCOPe Domain Sequences for d5ja1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ja1b_ d.100.2.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
fsnpfddpqgafyilrnaqgqfslwpqqcvlpagwdivcqpqsqascqqwleahwrtltp
tnftql

SCOPe Domain Coordinates for d5ja1b_:

Click to download the PDB-style file with coordinates for d5ja1b_.
(The format of our PDB-style files is described here.)

Timeline for d5ja1b_: