SCOPe 2.08: Domain d5ja1b_: 5ja1 B:

Lineage for d5ja1b_ (5ja1 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.2: MbtH-like [160582] (2 families)
   the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position

5. Family d.100.2.0: automated matches [254253] (1 protein)
   not a true family

6. Protein automated matches [254578] (8 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [346372] (1 PDB entry)

8. Domain d5ja1b_: 5ja1 B: [345692]
   automated match to d5u89b_
   complexed with 75c, cl

Details for d5ja1b_

PDB Entry: 5ja1, 3 Å

PDB Description: entf, a terminal nonribosomal peptide synthetase module bound to the mbth-like protein ybdz

PDB Compounds: (B:) Enterobactin biosynthesis protein YbdZ

SCOPe Domain Sequences for d5ja1b_:

Sequence; same for both SEQRES and ATOM records:

>d5ja1b_ d.100.2.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
fsnpfddpqgafyilrnaqgqfslwpqqcvlpagwdivcqpqsqascqqwleahwrtltp
tnftql

Timeline for d5ja1b_:

• d5ja1b_ first appeared in SCOPe 2.07