Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Burkholderia vietnamiensis [TaxId:269482] [315019] (4 PDB entries) |
Domain d5idwa_: 5idw A: [345688] automated match to d5tt1a_ complexed with nap |
PDB Entry: 5idw (more details), 2 Å
SCOPe Domain Sequences for d5idwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5idwa_ c.2.1.0 (A:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]} mktvlivgasrglgrefvrqyrrdgwnviatarddaslaalraagahahaldiaqpeqia algwkldgerldaavlvsgvygprtegvetignedfdavmhtnvrgpmqllpivlplved argvlavvssrmgsiadatgttgwlyraskaalndvlriaslqtrhaacislhpgwvrtd mggaeaaidpetsvtgmrrviaeagadvsrangrflqydgvelsw
Timeline for d5idwa_: