Lineage for d5idwa_ (5idw A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2454822Species Burkholderia vietnamiensis [TaxId:269482] [315019] (4 PDB entries)
  8. 2454829Domain d5idwa_: 5idw A: [345688]
    automated match to d5tt1a_
    complexed with nap

Details for d5idwa_

PDB Entry: 5idw (more details), 2 Å

PDB Description: crystal structure of an oxidoreductase from burkholderia vietnamiensis in complex with nadp
PDB Compounds: (A:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d5idwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5idwa_ c.2.1.0 (A:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
mktvlivgasrglgrefvrqyrrdgwnviatarddaslaalraagahahaldiaqpeqia
algwkldgerldaavlvsgvygprtegvetignedfdavmhtnvrgpmqllpivlplved
argvlavvssrmgsiadatgttgwlyraskaalndvlriaslqtrhaacislhpgwvrtd
mggaeaaidpetsvtgmrrviaeagadvsrangrflqydgvelsw

SCOPe Domain Coordinates for d5idwa_:

Click to download the PDB-style file with coordinates for d5idwa_.
(The format of our PDB-style files is described here.)

Timeline for d5idwa_: