Lineage for d5idqb_ (5idq B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (259 species)
    not a true protein
  7. 2430859Species Burkholderia vietnamiensis [TaxId:269482] [315019] (4 PDB entries)
  8. 2430861Domain d5idqb_: 5idq B: [345687]
    Other proteins in same PDB: d5idqa2
    automated match to d5tt1a_

Details for d5idqb_

PDB Entry: 5idq (more details), 1.55 Å

PDB Description: crystal structure of a short-chain dehydrogenase/reductase (sdr)from burkholderia vietnamiensis at 1.55 a resolution
PDB Compounds: (B:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d5idqb_:

Sequence, based on SEQRES records: (download)

>d5idqb_ c.2.1.0 (B:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
mktvlivgasrglgrefvrqyrrdgwnviatarddaslaalraagahahaldiaqpeqia
algwkldgerldaavlvsgvygprtegvetignedfdavmhtnvrgpmqllpivlplved
argvlavvssrmgsiadatgttgwlyraskaalndvlriaslqtrhaacislhpgwvrtd
mggaeaaidpetsvtgmrrviaeagadvsrangrflqydgvelsw

Sequence, based on observed residues (ATOM records): (download)

>d5idqb_ c.2.1.0 (B:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
mktvlivgasrglgrefvrqyrrdgwnviatarddaslaalraagahahaldiaqpeqia
algwkldgerldaavlvsgvygprtegvetignedfdavmhtnvrgpmqllpivlplved
argvlavvssrmgsiadatgttgwlyraskaalndvlriaslqtrhaacislhpgwvaid
petsvtgmrrviaeagadvsrangrflqydgvelsw

SCOPe Domain Coordinates for d5idqb_:

Click to download the PDB-style file with coordinates for d5idqb_.
(The format of our PDB-style files is described here.)

Timeline for d5idqb_:

  • d5idqb_ is new in SCOPe 2.07-stable