Lineage for d5idqa1 (5idq A:1-225)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (259 species)
    not a true protein
  7. 2430859Species Burkholderia vietnamiensis [TaxId:269482] [315019] (4 PDB entries)
  8. 2430860Domain d5idqa1: 5idq A:1-225 [345685]
    Other proteins in same PDB: d5idqa2
    automated match to d5tt1a_

Details for d5idqa1

PDB Entry: 5idq (more details), 1.55 Å

PDB Description: crystal structure of a short-chain dehydrogenase/reductase (sdr)from burkholderia vietnamiensis at 1.55 a resolution
PDB Compounds: (A:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d5idqa1:

Sequence, based on SEQRES records: (download)

>d5idqa1 c.2.1.0 (A:1-225) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
mktvlivgasrglgrefvrqyrrdgwnviatarddaslaalraagahahaldiaqpeqia
algwkldgerldaavlvsgvygprtegvetignedfdavmhtnvrgpmqllpivlplved
argvlavvssrmgsiadatgttgwlyraskaalndvlriaslqtrhaacislhpgwvrtd
mggaeaaidpetsvtgmrrviaeagadvsrangrflqydgvelsw

Sequence, based on observed residues (ATOM records): (download)

>d5idqa1 c.2.1.0 (A:1-225) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
mktvlivgasrglgrefvrqyrrdgwnviatarddaslaalraagahahaldiaqpeqia
algwkldgerldaavlvsgvygprtegvetignedfdavmhtnvrgpmqllpivlplved
argvlavvssrmgsiadatgttgwlyraskaalndvlriaslqtrhaacislhpgwvrai
dpetsvtgmrrviaeagadvsrangrflqydgvelsw

SCOPe Domain Coordinates for d5idqa1:

Click to download the PDB-style file with coordinates for d5idqa1.
(The format of our PDB-style files is described here.)

Timeline for d5idqa1:

  • d5idqa1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5idqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d5idqb_