![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Methanohalophilus portucalensis [TaxId:523843] [326452] (7 PDB entries) |
![]() | Domain d5hiia_: 5hii A: [345671] automated match to d5h02a_ complexed with edo |
PDB Entry: 5hii (more details), 1.9 Å
SCOPe Domain Sequences for d5hiia_:
Sequence, based on SEQRES records: (download)
>d5hiia_ c.66.1.0 (A:) automated matches {Methanohalophilus portucalensis [TaxId: 523843]} sdhyeeeyvlgfvdkwdelidwesraesegdtiinilkergvkkvldvatgtgfnsvrll qagfdvvsadgsaemlvkafdnardhgylmrtvqadwrwmnkdihdkfdaivclgnsfth lfdegdrrkalaefyallkhdgvllldqrnydailddgysskhahyycgdtvsvypehvd eglarfkyefsdgsvynlnmfplrkdytrqllhevgfqeintlgdfketykedepdfflh vaekn
>d5hiia_ c.66.1.0 (A:) automated matches {Methanohalophilus portucalensis [TaxId: 523843]} sdhyeeeyvlgfvdkwdelidwesraesegdtiinilkergvkkvldvatgtgfnsvrll qagfdvvsadgsaemlvkafdnardhgylmrtvqadwrwmnkdihdkfdaivclgnsfth lfdegdrrkalaefyallkhdgvllldqrnydaildskhahyycgdtvsvypehvdegla rfkyefsdgsvynlnmfplrkdytrqllhevgfqeintlgdfketykedepdfflhvaek n
Timeline for d5hiia_: