SCOPe 2.08: Domain d5gtix_: 5gti X:

Lineage for d5gtix_ (5gti X:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family)
   Pfam PF06596

5. Family f.23.40.1: PsbX-like [267615] (2 proteins)

6. Protein automated matches [267680] (2 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (27 PDB entries)

8. Domain d5gtix_: 5gti X: [345666]
   Other proteins in same PDB: d5gtia_, d5gtib_, d5gtic_, d5gtid_, d5gtie_, d5gtif_, d5gtih_, d5gtii_, d5gtij_, d5gtik_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtit_, d5gtiu_, d5gtiv_, d5gtiz_
   automated match to d4il6x_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gtix_

PDB Entry: 5gti, 2.5 Å

PDB Description: native xfel structure of photosystem ii (two flash dataset)

PDB Compounds: (X:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d5gtix_:

Sequence; same for both SEQRES and ATOM records:

>d5gtix_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqr

Timeline for d5gtix_:

• d5gtix_ first appeared in SCOPe 2.07