SCOPe 2.08: Domain d5gtik_: 5gti K:

Lineage for d5gtik_ (5gti K:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families)
   automatically mapped to Pfam PF02533

5. Family f.23.36.1: PsbK-like [161038] (2 proteins)
   Pfam PF02533

6. Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (26 PDB entries)

8. Domain d5gtik_: 5gti K: [345658]
   Other proteins in same PDB: d5gtia_, d5gtib_, d5gtic_, d5gtid_, d5gtie_, d5gtif_, d5gtih_, d5gtii_, d5gtij_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtit_, d5gtiu_, d5gtiv_, d5gtix_, d5gtiz_
   automated match to d2axtk1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gtik_

PDB Entry: 5gti, 2.5 Å

PDB Description: native xfel structure of photosystem ii (two flash dataset)

PDB Compounds: (K:) Photosystem II PsbK protein

SCOPe Domain Sequences for d5gtik_:

Sequence; same for both SEQRES and ATOM records:

>d5gtik_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

Timeline for d5gtik_:

• d5gtik_ first appeared in SCOPe 2.07