SCOPe 2.08: Domain d5gtih_: 5gti H:

Lineage for d5gtih_ (5gti H:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families)
   automatically mapped to Pfam PF00737

5. Family f.23.33.1: PsbH-like [161026] (2 proteins)
   Pfam PF00737

6. Protein automated matches [191001] (5 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189915] (8 PDB entries)

8. Domain d5gtih_: 5gti H: [345655]
   Other proteins in same PDB: d5gtia_, d5gtib_, d5gtic_, d5gtid_, d5gtie_, d5gtif_, d5gtii_, d5gtij_, d5gtik_, d5gtil_, d5gtim1, d5gtim2, d5gtio_, d5gtit_, d5gtiu_, d5gtiv_, d5gtix_, d5gtiz_
   automated match to d5v2ch_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d5gtih_

PDB Entry: 5gti, 2.5 Å

PDB Description: native xfel structure of photosystem ii (two flash dataset)

PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5gtih_:

Sequence; same for both SEQRES and ATOM records:

>d5gtih_ f.23.33.1 (H:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkal

Timeline for d5gtih_:

• d5gtih_ first appeared in SCOPe 2.07