| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
| Family c.10.2.4: U2A'-like [52068] (2 proteins) duplication: consists of 5-6 partly irregular repeats this is a repeat family; one repeat unit is 1a9n C:89-114 found in domain |
| Protein Spliceosomal U2 small nuclear ribonucleoprotein A' / U2A' / Lea1 protein [52069] (2 species) 3jb9 chain j is Lea1 from fission yeast; not included because sids are not case sensitive |
| Species Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292] [346281] (1 PDB entry) |
| Domain d5gmkb_: 5gmk b: [345639] Other proteins in same PDB: d5gmka_, d5gmkd_, d5gmkf_, d5gmkg_, d5gmkh_, d5gmki_, d5gmkn1, d5gmkn2, d5gmkv_ protein/RNA complex; complexed with gtp, mg, zn |
PDB Entry: 5gmk (more details), 3.4 Å
SCOPe Domain Sequences for d5gmkb_:
Sequence, based on SEQRES records: (download)
>d5gmkb_ c.10.2.4 (b:) Spliceosomal U2 small nuclear ribonucleoprotein A' / U2A' / Lea1 protein {Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId: 559292]}
mkftpsividapqyyvdhfngkynvdkcvilrdlqletdsesmpsslkhltkpthildlt
nndlimipdlsrrddihtlllgrnnivevdgrllpmnvqnltlsnnsirrfedlqrlrra
prtlknltlignqvchlanyrehvlrlvphletldfqnvtae
>d5gmkb_ c.10.2.4 (b:) Spliceosomal U2 small nuclear ribonucleoprotein A' / U2A' / Lea1 protein {Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId: 559292]}
mkftpsividapqyyvddlqletesmpsslkhltkpthildltnndlimipdlsrrddih
tlllgrnnivevdvqnltlsnnsirrfedlqrlrralknltlignqvchlanyrehvlrl
vphletldfqnvtae
Timeline for d5gmkb_: