Lineage for d5f5tb_ (5f5t B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334647Superfamily a.118.30: Pre-mRNA splicing factor Prp38 N-terminal-like [345917] (1 family) (S)
    Pfam PF03371
    Structural similarity to HEAT repeats, according to PubMed 26673105
    Some loops between helices form beta hairpins
  5. 2334648Family a.118.30.1: Pre-mRNA splicing factor Prp38-like [345958] (1 protein)
  6. 2334649Protein Pre-mRNA splicing factor Prp38A [346044] (2 species)
  7. 2334650Species Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272] [346207] (3 PDB entries)
  8. 2334652Domain d5f5tb_: 5f5t B: [345621]
    protein/RNA complex

Details for d5f5tb_

PDB Entry: 5f5t (more details), 2.55 Å

PDB Description: crystal structure of the prp38-mfap1 complex of chaetomium thermophilum
PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d5f5tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f5tb_ a.118.30.1 (B:) Pre-mRNA splicing factor Prp38A {Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId: 759272]}
pdthraderrfldergssgplapnglnpatimekavrerivesyfwkeqcfgvneadivd
rvvehvrfvggvtgvtqkpspflclafkllqlapgddilkeylyfggekfkylralaafy
irltrpdkevytllepfledrrklrrkgkngtsltymdefiddlltkdrvcstslwkmrr
rdiledldlleprvsplgsledileeeeqaakne

SCOPe Domain Coordinates for d5f5tb_:

Click to download the PDB-style file with coordinates for d5f5tb_.
(The format of our PDB-style files is described here.)

Timeline for d5f5tb_:

  • d5f5tb_ is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d5f5ta_