Lineage for d5f5sa1 (5f5s A:1-176)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334647Superfamily a.118.30: Pre-mRNA splicing factor Prp38 N-terminal-like [345917] (1 family) (S)
    Pfam PF03371
    Structural similarity to HEAT repeats, according to PubMed 26673105
    Some loops between helices form beta hairpins
  5. 2334648Family a.118.30.1: Pre-mRNA splicing factor Prp38-like [345958] (1 protein)
  6. 2334649Protein Pre-mRNA splicing factor Prp38A [346044] (2 species)
  7. 2334658Species Human (Homo sapiens) [TaxId:9606] [346208] (4 PDB entries)
  8. 2334661Domain d5f5sa1: 5f5s A:1-176 [345618]
    Other proteins in same PDB: d5f5sa2
    protein/RNA complex

Details for d5f5sa1

PDB Entry: 5f5s (more details), 2.4 Å

PDB Description: crystal structure of the prp38-mfap1 complex of homo sapiens
PDB Compounds: (A:) Pre-mRNA-splicing factor 38A

SCOPe Domain Sequences for d5f5sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f5sa1 a.118.30.1 (A:1-176) Pre-mRNA splicing factor Prp38A {Human (Homo sapiens) [TaxId: 9606]}
manrtvkdahsihgtnpqylvekiirtriyeskywkeecfgltaelvvdkamelrfvggv
yggnikptpflcltlkmlqiqpekdiivefiknedfkyvrmlgalymrltgtaidcykyl
eplyndyrkiksqnrngefelmhvdefidellhservcdiilprlqkryvleeaeq

SCOPe Domain Coordinates for d5f5sa1:

Click to download the PDB-style file with coordinates for d5f5sa1.
(The format of our PDB-style files is described here.)

Timeline for d5f5sa1:

  • d5f5sa1 is new in SCOPe 2.07-stable