SCOPe 2.08: Domain d5f48b_: 5f48 B:

Lineage for d5f48b_ (5f48 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [314792] (6 PDB entries)

8. Domain d5f48b_: 5f48 B: [345613]
   automated match to d5f47b_
   complexed with cl, coa, mg

Details for d5f48b_

PDB Entry: 5f48, 1.95 Å

PDB Description: crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with coenzyme a

PDB Compounds: (B:) aminoglycoside acetyltransferase meta-AAC0020

SCOPe Domain Sequences for d5f48b_:

Sequence; same for both SEQRES and ATOM records:

>d5f48b_ d.108.1.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
idnflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvfvallen
kivggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgfeevfvq
adkvddyaldfyrstkptaeeqvvhfyytlk

Timeline for d5f48b_:

• d5f48b_ first appeared in SCOPe 2.07