SCOPe 2.07: Domain d5f46a_: 5f46 A:

Lineage for d5f46a_ (5f46 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [314792] (6 PDB entries)

8. Domain d5f46a_: 5f46 A: [345610]
   automated match to d5f47b_
   complexed with cl

Details for d5f46a_

PDB Entry: 5f46, 1.85 Å

PDB Description: crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample, apoenzyme form

PDB Compounds: (A:) aminoglycoside acetyltransferase HMB0020

SCOPe Domain Sequences for d5f46a_:

Sequence; same for both SEQRES and ATOM records:

>d5f46a_ d.108.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
dnflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvfvallenk
ivggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgfeevfvqa
dkvddyaldfyrstkptaeeqvvhfyytlk

Timeline for d5f46a_:

• d5f46a_ is new in SCOPe 2.07-stable
  
• d5f46a_ appears in the current release, SCOPe 2.08