SCOPe 2.08: Domain d5drwb2: 5drw B:114-217

Lineage for d5drwb2 (5drw B:114-217)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5drwb2: 5drw B:114-217 [345594]
   automated match to d4uv7l2

Details for d5drwb2

PDB Entry: 5drw, 2.27 Å

PDB Description: crystal structure of the bcr fab fragment from subset #4 case cll183

PDB Compounds: (B:) CLL183 BCR antibody light chain

SCOPe Domain Sequences for d5drwb2:

Sequence; same for both SEQRES and ATOM records:

>d5drwb2 b.1.1.0 (B:114-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d5drwb2:

• d5drwb2 first appeared in SCOPe 2.07