SCOPe 2.08: Domain d5diie2: 5dii E:119-205

Lineage for d5diie2 (5dii E:119-205)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.56: CcmK-like [143414] (2 families)
contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
Family d.58.56.0: automated matches [195116] (1 protein)
not a true family
Protein automated matches [195117] (13 species)
not a true protein
Species Haliangium ochraceum [TaxId:502025] [279894] (3 PDB entries)
Domain d5diie2: 5dii E:119-205 [345592]
automated match to d3nwga2
complexed with sf4

Details for d5diie2

PDB Entry: 5dii (more details), 1.8 Å

PDB Description: structure of an engineered bacterial microcompartment shell protein binding a [4fe-4s] cluster

PDB Compounds: (E:) Microcompartments protein

SCOPe Domain Sequences for d5diie2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5diie2 d.58.56.0 (E:119-205) automated matches {Haliangium ochraceum [TaxId: 502025]}
esviivetatvcaaidsadaalktapvvlrdmrlaigiagkafftltgeladveaaaevv
rercgarllelaciarpvdelrgrlff

SCOPe Domain Coordinates for d5diie2:

Click to download the PDB-style file with coordinates for d5diie2.
(The format of our PDB-style files is described here.)

Timeline for d5diie2: