Lineage for d5diie1 (5dii E:7-114)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562704Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2562793Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 2562794Protein automated matches [195117] (12 species)
    not a true protein
  7. 2562841Species Haliangium ochraceum [TaxId:502025] [279894] (3 PDB entries)
  8. 2562844Domain d5diie1: 5dii E:7-114 [345591]
    automated match to d3nwga1
    complexed with sf4

Details for d5diie1

PDB Entry: 5dii (more details), 1.8 Å

PDB Description: structure of an engineered bacterial microcompartment shell protein binding a [4fe-4s] cluster
PDB Compounds: (E:) Microcompartments protein

SCOPe Domain Sequences for d5diie1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5diie1 d.58.56.0 (E:7-114) automated matches {Haliangium ochraceum [TaxId: 502025]}
rfdatppagepdrpalgvleltsiargitvadaalkrapslllmsrpvcsgkhllmmrgq
vaeveesmiaareiagagsgalldelelpyaheqlwrfldapvvadaw

SCOPe Domain Coordinates for d5diie1:

Click to download the PDB-style file with coordinates for d5diie1.
(The format of our PDB-style files is described here.)

Timeline for d5diie1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5diie2