| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) ![]() contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
| Family d.58.56.0: automated matches [195116] (1 protein) not a true family |
| Protein automated matches [195117] (12 species) not a true protein |
| Species Haliangium ochraceum [TaxId:502025] [279894] (3 PDB entries) |
| Domain d5diie1: 5dii E:7-114 [345591] automated match to d3nwga1 complexed with sf4 |
PDB Entry: 5dii (more details), 1.8 Å
SCOPe Domain Sequences for d5diie1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5diie1 d.58.56.0 (E:7-114) automated matches {Haliangium ochraceum [TaxId: 502025]}
rfdatppagepdrpalgvleltsiargitvadaalkrapslllmsrpvcsgkhllmmrgq
vaeveesmiaareiagagsgalldelelpyaheqlwrfldapvvadaw
Timeline for d5diie1: