SCOPe 2.07: Domain d5dihf2: 5dih F:119-205

Lineage for d5dihf2 (5dih F:119-205)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (2 families)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.0: automated matches [195116] (1 protein)
   not a true family

6. Protein automated matches [195117] (12 species)
   not a true protein

7. Species Haliangium ochraceum [TaxId:502025] [279894] (3 PDB entries)

8. Domain d5dihf2: 5dih F:119-205 [345588]
   automated match to d3nwga2

Details for d5dihf2

PDB Entry: 5dih, 2.44 Å

PDB Description: structure of haliangium ochraceum bmc-t ho-5812

PDB Compounds: (F:) Microcompartments protein

SCOPe Domain Sequences for d5dihf2:

Sequence; same for both SEQRES and ATOM records:

>d5dihf2 d.58.56.0 (F:119-205) automated matches {Haliangium ochraceum [TaxId: 502025]}
esviivetatvcaaidsadaalktapvvlrdmrlaigiagkafftltgeladveaaaevv
rercgarllelaciarpvdelrgrlff

Timeline for d5dihf2:

• d5dihf2 is new in SCOPe 2.07-stable
  
• d5dihf2 appears in the current release, SCOPe 2.08