Lineage for d1g2vc_ (1g2v C:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841352Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 841353Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (19 families) (S)
  5. 841456Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (3 proteins)
  6. 841475Protein RmlA (RfbA) [53465] (4 species)
  7. 841494Species Pseudomonas aeruginosa [TaxId:287] [53466] (7 PDB entries)
  8. 841529Domain d1g2vc_: 1g2v C: [34558]

Details for d1g2vc_

PDB Entry: 1g2v (more details), 2.6 Å

PDB Description: the structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). ttp complex.
PDB Compounds: (C:) glucose-1-phosphate thymidylyltransferase

SCOP Domain Sequences for d1g2vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2vc_ c.68.1.6 (C:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]}
krkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdtp
rfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhel
lgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydqq
vvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfiat
lenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy

SCOP Domain Coordinates for d1g2vc_:

Click to download the PDB-style file with coordinates for d1g2vc_.
(The format of our PDB-style files is described here.)

Timeline for d1g2vc_: