Lineage for d5cf3a1 (5cf3 A:2-148)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767842Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2767843Protein automated matches [190503] (10 species)
    not a true protein
  7. 2767910Species Staphylococcus aureus [TaxId:1280] [346218] (1 PDB entry)
  8. 2767911Domain d5cf3a1: 5cf3 A:2-148 [345570]
    Other proteins in same PDB: d5cf3a3
    automated match to d5wtaa1
    complexed with ca

Details for d5cf3a1

PDB Entry: 5cf3 (more details), 2.03 Å

PDB Description: crystal structures of bbp from staphylococcus aureus
PDB Compounds: (A:) Bone sialoprotein-binding protein

SCOPe Domain Sequences for d5cf3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cf3a1 b.2.3.0 (A:2-148) automated matches {Staphylococcus aureus [TaxId: 1280]}
snnvndlitvtkqmitegikddgviqahdgehiiytsdfkidnavkagdtmtvkydkhti
psditddftpvditdpsgeviakgtfdlntktitykftdyvdryenvnaklelnsyidkk
evpnetnlnltfatadketsknvkvey

SCOPe Domain Coordinates for d5cf3a1:

Click to download the PDB-style file with coordinates for d5cf3a1.
(The format of our PDB-style files is described here.)

Timeline for d5cf3a1: