![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.0: automated matches [191391] (1 protein) not a true family |
![]() | Protein automated matches [190503] (10 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [346218] (1 PDB entry) |
![]() | Domain d5cf3a1: 5cf3 A:2-148 [345570] Other proteins in same PDB: d5cf3a3 automated match to d5wtaa1 complexed with ca |
PDB Entry: 5cf3 (more details), 2.03 Å
SCOPe Domain Sequences for d5cf3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cf3a1 b.2.3.0 (A:2-148) automated matches {Staphylococcus aureus [TaxId: 1280]} snnvndlitvtkqmitegikddgviqahdgehiiytsdfkidnavkagdtmtvkydkhti psditddftpvditdpsgeviakgtfdlntktitykftdyvdryenvnaklelnsyidkk evpnetnlnltfatadketsknvkvey
Timeline for d5cf3a1: