SCOPe 2.08: Domain d5b6fg2: 5b6f G:132-236

Lineage for d5b6fg2 (5b6f G:132-236)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5b6fg2: 5b6f G:132-236 [345558]
   Other proteins in same PDB: d5b6fb_, d5b6fd_, d5b6ff_, d5b6fh_
   automated match to d5fhxl3
   complexed with ltx, mes, so4

Details for d5b6fg2

PDB Entry: 5b6f, 2.1 Å

PDB Description: crystal structure of the fab fragment of an anti-leukotriene c4 monoclonal antibody complexed with ltc4

PDB Compounds: (G:) anti-leukotriene C4 monoclonal antibody immunoglobulin kappa light chain

SCOPe Domain Sequences for d5b6fg2:

Sequence; same for both SEQRES and ATOM records:

>d5b6fg2 b.1.1.0 (G:132-236) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d5b6fg2:

• d5b6fg2 first appeared in SCOPe 2.07