Lineage for d5b6fg1 (5b6f G:20-131)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760197Domain d5b6fg1: 5b6f G:20-131 [345557]
    Other proteins in same PDB: d5b6fb_, d5b6fd_, d5b6ff_, d5b6fh_
    automated match to d5fhxl1
    complexed with ltx, mes, so4

Details for d5b6fg1

PDB Entry: 5b6f (more details), 2.1 Å

PDB Description: crystal structure of the fab fragment of an anti-leukotriene c4 monoclonal antibody complexed with ltc4
PDB Compounds: (G:) anti-leukotriene C4 monoclonal antibody immunoglobulin kappa light chain

SCOPe Domain Sequences for d5b6fg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b6fg1 b.1.1.0 (G:20-131) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwflqkpgqspklliykvsnrf
sgvperfsgsgsgtdftlkisrveaedlgvyfcsqskyvpytfgggtkleik

SCOPe Domain Coordinates for d5b6fg1:

Click to download the PDB-style file with coordinates for d5b6fg1.
(The format of our PDB-style files is described here.)

Timeline for d5b6fg1: