SCOPe 2.07: Domain d5axwa4: 5axw A:782-1052

Lineage for d5axwa4 (5axw A:782-1052)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.80: CRISPR-associated endonuclease Cas9/Csn1, Protospace-adjacent motif (PAM)-interacting domain [345893] (1 superfamily)
   N-terminal part is structurally divergent wedge domain; middle domain is homologous to DNA gyrase B and Topoisomerase II; C-terminal domain appears to be Cas9-specific

4. Superfamily e.80.1: CRISPR-associated endonuclease Cas9/Csn1, PAM-interacting (PI) domain [345926] (1 family)
   Pfam PF16595

5. Family e.80.1.1: CRISPR-associated endonuclease Cas9/Csn1, PAM-interacting (PI) domain [345982] (1 protein)

6. Protein CRISPR-associated endonuclease Cas9/Csn1, PI domain [346119] (3 species)

7. Species Staphylococcus aureus subsp. aureus [TaxId:46170] [346417] (1 PDB entry)

8. Domain d5axwa4: 5axw A:782-1052 [345544]
   Other proteins in same PDB: d5axwa1, d5axwa2, d5axwa3
   protein/DNA complex; protein/RNA complex; complexed with edo, na, po4

Details for d5axwa4

PDB Entry: 5axw, 2.7 Å

PDB Description: crystal structure of staphylococcus aureus cas9 in complex with sgrna and target dna (ttgggt pam)

PDB Compounds: (A:) CRISPR-associated endonuclease Cas9

SCOPe Domain Sequences for d5axwa4:

Sequence; same for both SEQRES and ATOM records:

>d5axwa4 e.80.1.1 (A:782-1052) CRISPR-associated endonuclease Cas9/Csn1, PI domain {Staphylococcus aureus subsp. aureus [TaxId: 46170]}
elindtlystrkddkgntlivnnlnglydkdndklkklinkspekllmyhhdpqtyqklk
limeqygdeknplykyyeetgnyltkyskkdngpvikkikyygnklnahlditddypnsr
nkvvklslkpyrfdvyldngvykfvtvknldvikkenyyevnskayeeakklkkisnqae
fiasfynndlikingelyrvigvnndllnrievnmidityreylenmndkrppriiktia
sktqsikkystdilgnlyevkskkhpqiikk

Timeline for d5axwa4:

• d5axwa4 is new in SCOPe 2.07-stable
  
• d5axwa4 appears in the current release, SCOPe 2.08