SCOPe 2.08: Domain d5axwa3: 5axw A:41-429

Lineage for d5axwa3 (5axw A:41-429)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.393: CRISPR-associated endonuclease Cas9/Csn1, Target recognition (REC) lobe [345890] (1 superfamily)
   Mostly helical, complex structure

4. Superfamily d.393.1: CRISPR-associated endonuclease Cas9/Csn1, Target recognition (REC) lobe [345923] (1 family)
   Pfam PF16593, Pfam PF13395

5. Family d.393.1.1: CRISPR-associated endonuclease Cas9/Csn1, Target recognition (REC) lobe [345978] (1 protein)

6. Protein CRISPR-associated endonuclease Cas9/Csn1, REC lobe [346112] (3 species)

7. Species Staphylococcus aureus subsp. aureus [TaxId:46170] [346401] (1 PDB entry)

8. Domain d5axwa3: 5axw A:41-429 [345543]
   Other proteins in same PDB: d5axwa1, d5axwa2, d5axwa4
   protein/DNA complex; protein/RNA complex; complexed with edo, na, po4
   fragment; missing more than one-third of the common structure and/or sequence

Details for d5axwa3

PDB Entry: 5axw, 2.7 Å

PDB Description: crystal structure of staphylococcus aureus cas9 in complex with sgrna and target dna (ttgggt pam)

PDB Compounds: (A:) CRISPR-associated endonuclease Cas9

SCOPe Domain Sequences for d5axwa3:

Sequence; same for both SEQRES and ATOM records:

>d5axwa3 d.393.1.1 (A:41-429) CRISPR-associated endonuclease Cas9/Csn1, REC lobe {Staphylococcus aureus subsp. aureus [TaxId: 46170]}
vennegrrskrgarrlkrrrrhriqrvkkllfdynlltdhselsginpyearvkglsqkl
seeefsaallhlakrrgvhnvneveedtgnelstkeqisrnskaleekyvaelqlerlkk
dgevrgsinrfktsdyvkeakqllkvqkayhqldqsfidtyidlletrrtyyegpgegsp
fgwkdikewyemlmghctyfpeelrsvkyaynadlynalndlnnlvitrdenekleyyek
fqiienvfkqkkkptlkqiakeilvneedikgyrvtstgkpeftnlkvyhdikditarke
iienaelldqiakiltiyqssediqeeltnlnseltqeeieqisnlkgytgthnlslkai
nlildelwhtndnqiaifnrlklvpkkvd

Timeline for d5axwa3:

• d5axwa3 first appeared in SCOPe 2.07