Lineage for d5axwa2 (5axw A:484-630)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535017Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2535018Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2535160Family d.4.1.8: HNH domain from CRISPR-associated protein Cas9 [345970] (1 protein)
    Homology to HNH nucleases noted in PubMed 21756346
    Pfam PF13395
  6. 2535161Protein CRISPR-associated endonuclease Cas9/Csn1, HNH domain [346090] (3 species)
  7. 2535164Species Staphylococcus aureus subsp. aureus [TaxId:46170] [346347] (1 PDB entry)
  8. 2535165Domain d5axwa2: 5axw A:484-630 [345542]
    Other proteins in same PDB: d5axwa1, d5axwa3, d5axwa4
    protein/DNA complex; protein/RNA complex; complexed with edo, na, po4

Details for d5axwa2

PDB Entry: 5axw (more details), 2.7 Å

PDB Description: crystal structure of staphylococcus aureus cas9 in complex with sgrna and target dna (ttgggt pam)
PDB Compounds: (A:) CRISPR-associated endonuclease Cas9

SCOPe Domain Sequences for d5axwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5axwa2 d.4.1.8 (A:484-630) CRISPR-associated endonuclease Cas9/Csn1, HNH domain {Staphylococcus aureus subsp. aureus [TaxId: 46170]}
skdaqkminemqkrnrqtnerieeiirttgkenakyliekiklhdmqegkclysleaipl
edllnnpfnyevdhiiprsvsfdnsfnnkvlvkqeeaskkgnrtpfqylsssdskisyet
fkkhilnlakgkgrisktkkeylleer

SCOPe Domain Coordinates for d5axwa2:

Click to download the PDB-style file with coordinates for d5axwa2.
(The format of our PDB-style files is described here.)

Timeline for d5axwa2: