| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) ![]() common motif contains conserved histidine residue and metal-binding site |
| Family d.4.1.8: HNH domain from CRISPR-associated protein Cas9 [345970] (1 protein) Homology to HNH nucleases noted in PubMed 21756346 Pfam PF13395 |
| Protein CRISPR-associated endonuclease Cas9/Csn1, HNH domain [346090] (3 species) |
| Species Staphylococcus aureus subsp. aureus [TaxId:46170] [346347] (1 PDB entry) |
| Domain d5axwa2: 5axw A:484-630 [345542] Other proteins in same PDB: d5axwa1, d5axwa3, d5axwa4 protein/DNA complex; protein/RNA complex; complexed with edo, na, po4 |
PDB Entry: 5axw (more details), 2.7 Å
SCOPe Domain Sequences for d5axwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5axwa2 d.4.1.8 (A:484-630) CRISPR-associated endonuclease Cas9/Csn1, HNH domain {Staphylococcus aureus subsp. aureus [TaxId: 46170]}
skdaqkminemqkrnrqtnerieeiirttgkenakyliekiklhdmqegkclysleaipl
edllnnpfnyevdhiiprsvsfdnsfnnkvlvkqeeaskkgnrtpfqylsssdskisyet
fkkhilnlakgkgrisktkkeylleer
Timeline for d5axwa2: