Lineage for d5avfa1 (5avf A:58-296)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970927Superfamily d.110.6: Sensory domain-like [103190] (5 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 2970986Family d.110.6.4: Histidine kinase family 1 (HK1) sensor domains [345974] (6 proteins)
    Pfam PF02743, contains double domain arrangement like LuxQ
  6. 2971024Protein automated matches [346106] (2 species)
    not a true protein
  7. 2971034Species Vibrio cholerae [TaxId:666] [346381] (2 PDB entries)
  8. 2971036Domain d5avfa1: 5avf A:58-296 [345537]
    Other proteins in same PDB: d5avfa2, d5avfb2
    automated match to d3c8ca_
    complexed with tau

Details for d5avfa1

PDB Entry: 5avf (more details), 1.95 Å

PDB Description: the ligand binding domain of mlp37 with taurine
PDB Compounds: (A:) Methyl-accepting chemotaxis (MCP) signaling domain protein

SCOPe Domain Sequences for d5avfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5avfa1 d.110.6.4 (A:58-296) automated matches {Vibrio cholerae [TaxId: 666]}
vrdeirsmvsdsvdeivdgvskttaevingrksiaqyatsliesnpepdnvrtiisqpli
kntfllvgfglekdgsninndpswnpgptwdprvrpwykdaknagklvitapyadsasge
ilvsvatpvkdsatgqflgsifydvslaelaelvnevklfdagyvfivsedgttiahpkk
efngkpmseflgeskinvdthqviingkpyavsfsdvegedwyvgvvideeiayaalde

SCOPe Domain Coordinates for d5avfa1:

Click to download the PDB-style file with coordinates for d5avfa1.
(The format of our PDB-style files is described here.)

Timeline for d5avfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5avfa2