Lineage for d5ajra1 (5ajr A:32-478)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2332286Species Trypanosoma cruzi [TaxId:5693] [196511] (19 PDB entries)
  8. 2332304Domain d5ajra1: 5ajr A:32-478 [345532]
    Other proteins in same PDB: d5ajra2
    automated match to d4uhia_
    complexed with hem, vt1

Details for d5ajra1

PDB Entry: 5ajr (more details), 2.75 Å

PDB Description: sterol 14-alpha demethylase (cyp51) from trypanosoma cruzi in complex with the 1-tetrazole derivative vt-1161 ((r)-2-( 2,4-difluorophenyl)-1,1-difluoro-3-(1h-tetrazol-1-yl)-1-(5- (4-(2,2,2-trifluoroethoxy)phenyl)pyridin-2-yl)propan-2-ol)
PDB Compounds: (A:) Sterol 14-alpha demethylase

SCOPe Domain Sequences for d5ajra1:

Sequence, based on SEQRES records: (download)

>d5ajra1 a.104.1.0 (A:32-478) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrffs
prneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhevr
kfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmesslipa
avfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllkavyr
dgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqln
ydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhde
eafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrde
vpdpdyhtmvvgptlnqclvkytrkkk

Sequence, based on observed residues (ATOM records): (download)

>d5ajra1 a.104.1.0 (A:32-478) automated matches {Trypanosoma cruzi [TaxId: 5693]}
ppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehsrffs
prneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhevr
kfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmesslipa
avfmpwllrllpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllkavyrd
gtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaqlny
dnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshhdee
afpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllrdev
pdpdyhtmvvgptlnqclvkytrkkk

SCOPe Domain Coordinates for d5ajra1:

Click to download the PDB-style file with coordinates for d5ajra1.
(The format of our PDB-style files is described here.)

Timeline for d5ajra1:

  • d5ajra1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5ajra2