Class a: All alpha proteins [46456] (290 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (6 species) not a true protein |
Species Horse (Equus caballus) [TaxId:9796] [256129] (26 PDB entries) |
Domain d4zbra3: 4zbr A:388-583 [345531] automated match to d1hk2a3 complexed with act, dif, fmt, lmr, mli, nps, sin |
PDB Entry: 4zbr (more details), 2.19 Å
SCOPe Domain Sequences for d4zbra3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zbra3 a.126.1.0 (A:388-583) automated matches {Horse (Equus caballus) [TaxId: 9796]} kkncdlfeevgeydfqnalivrytkkapqvstptlveigrtlgkvgsrccklpeserlpc senhlalalnrlcvlhektpvsekitkcctdslaerrpcfsaleldegyvpkefkaetft fhadictlpedekqikkqsalaelvkhkpkatkeqlktvlgnfsafvakccgaedkeacf aeegpklvassqlala
Timeline for d4zbra3: