SCOPe 2.08: Domain d4ywva_: 4ywv A:

Lineage for d4ywva_ (4ywv A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (61 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:1010840] [346331] (4 PDB entries)

8. Domain d4ywva_: 4ywv A: [345524]
   automated match to d3efvb_
   complexed with so4, ssn

Details for d4ywva_

PDB Entry: 4ywv, 2.4 Å

PDB Description: structural insight into the substrate inhibition mechanism of nadp+- dependent succinic semialdehyde dehydrogenase from streptococcus pyogenes

PDB Compounds: (A:) Succinic semialdehyde dehydrogenase

SCOPe Domain Sequences for d4ywva_:

Sequence; same for both SEQRES and ATOM records:

>d4ywva_ c.82.1.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 1010840]}
ayqtiypytnevlhtfdnmtdqgladvlerahllykkwrkedhleerkaqlhqvanilrr
drdkyaeimtkdmgklfteaqgevdlcadiadyyadkadeflmstpletdsgqayylkqs
tgvilavepwnfpyyqimrvfapnfivgnpmvlkhasicprsaqsfeelvleagaeagsi
tnlfisydqvsqviadkrvvgvcltgserggasiaeeagknlkkttlelggddafiildd
adwdqlekvlyfsrlynagqvctsskrfivldkdydrfkelltkvfktakwgdpmdpett
laplssaqakadvldqiklaldhgaelvyggeaidhpghfvmptiiagltkdnpiyyqei
fgpvgeiykvsseeeaievandsnyglggtifssnqehakavaakietgmsfinsgwtsl
pelpfggikhsgygrelselgftsfvnehliyipn

Timeline for d4ywva_:

• d4ywva_ first appeared in SCOPe 2.07