Lineage for d4yhwb_ (4yhw B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953323Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2953391Family d.58.10.3: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 C-terminal domain-like [345972] (1 protein)
    Pfam PF06544; relationship to BLUF domain discussed in PubMed 26161500
  6. 2953392Protein Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 [346095] (2 species)
  7. 2953393Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346360] (4 PDB entries)
  8. 2953399Domain d4yhwb_: 4yhw B: [345518]
    protein/RNA complex

Details for d4yhwb_

PDB Entry: 4yhw (more details), 3.25 Å

PDB Description: yeast prp3 (296-469) in complex with fragment of u4/u6 di-snrna
PDB Compounds: (B:) U4/U6 small nuclear ribonucleoprotein Prp3

SCOPe Domain Sequences for d4yhwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yhwb_ d.58.10.3 (B:) Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tvyhckvfqfknlqnpkirfklkmnskelslkglclrirddgpgiiivvgneksckfyen
lvmkrikwnedfelhtntgdikmdmhnnsisktwegylqdckfkgwfmkvcndqdsllrt
lgqfdsehfyspv

SCOPe Domain Coordinates for d4yhwb_:

Click to download the PDB-style file with coordinates for d4yhwb_.
(The format of our PDB-style files is described here.)

Timeline for d4yhwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4yhwa_