SCOPe 2.08: Domain d4yhwb_: 4yhw B:

Lineage for d4yhwb_ (4yhw B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families)

5. Family d.58.10.3: Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 C-terminal domain-like [345972] (1 protein)
   Pfam PF06544; relationship to BLUF domain discussed in PubMed 26161500

6. Protein Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 [346095] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346360] (4 PDB entries)

8. Domain d4yhwb_: 4yhw B: [345518]
   protein/RNA complex

Details for d4yhwb_

PDB Entry: 4yhw, 3.25 Å

PDB Description: yeast prp3 (296-469) in complex with fragment of u4/u6 di-snrna

PDB Compounds: (B:) U4/U6 small nuclear ribonucleoprotein Prp3

SCOPe Domain Sequences for d4yhwb_:

Sequence; same for both SEQRES and ATOM records:

>d4yhwb_ d.58.10.3 (B:) Spliceosomal U4/U6 small nuclear ribonucleoprotein Prp3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tvyhckvfqfknlqnpkirfklkmnskelslkglclrirddgpgiiivvgneksckfyen
lvmkrikwnedfelhtntgdikmdmhnnsisktwegylqdckfkgwfmkvcndqdsllrt
lgqfdsehfyspv

Timeline for d4yhwb_:

• d4yhwb_ first appeared in SCOPe 2.07