Lineage for d4wy8b1 (4wy8 B:3-319)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902888Species Rhizomucor miehei [TaxId:1031333] [346323] (1 PDB entry)
  8. 2902890Domain d4wy8b1: 4wy8 B:3-319 [345497]
    Other proteins in same PDB: d4wy8a2, d4wy8b2, d4wy8c2, d4wy8d2
    automated match to d5l2pa_

Details for d4wy8b1

PDB Entry: 4wy8 (more details), 2.27 Å

PDB Description: structural analysis of two fungal esterases from rhizomucor miehei explaining their substrate specificity
PDB Compounds: (B:) esterase

SCOPe Domain Sequences for d4wy8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wy8b1 c.69.1.0 (B:3-319) automated matches {Rhizomucor miehei [TaxId: 1031333]}
ptvklkpycqniadaatidstqyppevvrkaeaasiiddpkaleglpdvyleektinrkn
gskieltitrpldtenqvlppivffhgggwvvgsklthrrtvyeltvraraavifvnysl
spevrfptaleecldavvwvakeenaksinvdptklvvagdsaggnlsavvcirakqlgl
niikgqvliypvtddnfetdsykqfaenyyltrklmvwffdhyipdkkdrqsifacplka
siddlrvlpralvitaeadvlreegeayarklieagndvtavrylgiihgifnlatlspt
gseildhivawlqktwk

SCOPe Domain Coordinates for d4wy8b1:

Click to download the PDB-style file with coordinates for d4wy8b1.
(The format of our PDB-style files is described here.)

Timeline for d4wy8b1: