Lineage for d4uxjg1 (4uxj G:3-137)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480475Species Leishmania major [TaxId:5664] [225849] (4 PDB entries)
  8. 2480488Domain d4uxjg1: 4uxj G:3-137 [345475]
    Other proteins in same PDB: d4uxja2, d4uxjb2, d4uxjc2, d4uxjd2, d4uxje2, d4uxjf2, d4uxjg2, d4uxjh2
    automated match to d5fuwa1
    complexed with mg, ttp, zn

Details for d4uxjg1

PDB Entry: 4uxj (more details), 3 Å

PDB Description: leishmania major thymidine kinase in complex with dttp
PDB Compounds: (G:) Thymidine kinase

SCOPe Domain Sequences for d4uxjg1:

Sequence, based on SEQRES records: (download)

>d4uxjg1 c.37.1.0 (G:3-137) automated matches {Leishmania major [TaxId: 5664]}
rgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnvashdqlmlraq
aavsqltevrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgq
icelvpyceavdklt

Sequence, based on observed residues (ATOM records): (download)

>d4uxjg1 c.37.1.0 (G:3-137) automated matches {Leishmania major [TaxId: 5664]}
rgrieliigpmfagkttelmrrvkreiharrscfvikyskdtrydehnlraqaavsqlte
vrdtwkrfdvlaidegqffsdlvdfcntaadagkvvmvsaldgdyrrkpfgqicelvpyc
eavdklt

SCOPe Domain Coordinates for d4uxjg1:

Click to download the PDB-style file with coordinates for d4uxjg1.
(The format of our PDB-style files is described here.)

Timeline for d4uxjg1: