SCOPe 2.07: Domain d4uxjd2: 4uxj D:138-179

Lineage for d4uxjd2 (4uxj D:138-179)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.0: automated matches [191378] (1 protein)
   not a true family

6. Protein automated matches [190463] (9 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [346432] (3 PDB entries)

8. Domain d4uxjd2: 4uxj D:138-179 [345470]
   Other proteins in same PDB: d4uxja1, d4uxjb1, d4uxjc1, d4uxjd1, d4uxje1, d4uxjf1, d4uxjg1, d4uxjh1
   automated match to d5fuwa2
   complexed with mg, ttp, zn

Details for d4uxjd2

PDB Entry: 4uxj, 3 Å

PDB Description: leishmania major thymidine kinase in complex with dttp

PDB Compounds: (D:) Thymidine kinase

SCOPe Domain Sequences for d4uxjd2:

Sequence; same for both SEQRES and ATOM records:

>d4uxjd2 g.39.1.0 (D:138-179) automated matches {Leishmania major [TaxId: 5664]}
avcmmcheqpacftrrtvnveqqeliggadmyiatcrecysk

Timeline for d4uxjd2:

• d4uxjd2 is new in SCOPe 2.07-stable
  
• d4uxjd2 appears in the current release, SCOPe 2.08