Lineage for d4uxja2 (4uxj A:138-182)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3036144Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 3036145Protein automated matches [190463] (9 species)
    not a true protein
  7. 3036209Species Leishmania major [TaxId:5664] [346432] (3 PDB entries)
  8. 3036214Domain d4uxja2: 4uxj A:138-182 [345464]
    Other proteins in same PDB: d4uxja1, d4uxjb1, d4uxjc1, d4uxjd1, d4uxje1, d4uxjf1, d4uxjg1, d4uxjh1
    automated match to d5fuwa2
    complexed with mg, ttp, zn

Details for d4uxja2

PDB Entry: 4uxj (more details), 3 Å

PDB Description: leishmania major thymidine kinase in complex with dttp
PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d4uxja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uxja2 g.39.1.0 (A:138-182) automated matches {Leishmania major [TaxId: 5664]}
avcmmcheqpacftrrtvnveqqeliggadmyiatcrecyskqql

SCOPe Domain Coordinates for d4uxja2:

Click to download the PDB-style file with coordinates for d4uxja2.
(The format of our PDB-style files is described here.)

Timeline for d4uxja2: