SCOPe 2.08: Domain d4uxhb2: 4uxh B:138-181

Lineage for d4uxhb2 (4uxh B:138-181)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.0: automated matches [191378] (1 protein)
   not a true family

6. Protein automated matches [190463] (9 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [346432] (3 PDB entries)

8. Domain d4uxhb2: 4uxh B:138-181 [345458]
   Other proteins in same PDB: d4uxha1, d4uxhb1
   automated match to d5fuwa2
   complexed with t5a, zn

Details for d4uxhb2

PDB Entry: 4uxh, 2.4 Å

PDB Description: leishmania major thymidine kinase in complex with ap5dt

PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d4uxhb2:

Sequence; same for both SEQRES and ATOM records:

>d4uxhb2 g.39.1.0 (B:138-181) automated matches {Leishmania major [TaxId: 5664]}
avcmmcheqpacftrrtvnveqqeliggadmyiatcrecyskqq

Timeline for d4uxhb2:

• d4uxhb2 first appeared in SCOPe 2.07