Lineage for d4ufrd_ (4ufr D:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582446Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 2582517Family g.3.9.0: automated matches [232406] (1 protein)
    not a true family
  6. 2582518Protein automated matches [232407] (3 species)
    not a true protein
  7. 2582519Species Human (Homo sapiens) [TaxId:9606] [232408] (16 PDB entries)
  8. 2582531Domain d4ufrd_: 4ufr D: [345454]
    automated match to d4cdke_
    complexed with cl, nag

Details for d4ufrd_

PDB Entry: 4ufr (more details), 2.2 Å

PDB Description: structure of the ectodomain of lgr5 in complex with r-spondin-2 (fu1fu2)
PDB Compounds: (D:) r-spondin-2

SCOPe Domain Sequences for d4ufrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ufrd_ g.3.9.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ckgclscskdngcsrcqqklffflrregmrqygeclhscpsgyyghrapdmnrcarcrie
ncdscfskdfctkckvgfylhrgrcfdecpdgfapldetmec

SCOPe Domain Coordinates for d4ufrd_:

Click to download the PDB-style file with coordinates for d4ufrd_.
(The format of our PDB-style files is described here.)

Timeline for d4ufrd_:

  • d4ufrd_ is new in SCOPe 2.07-stable