Lineage for d4uava_ (4uav A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920671Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [346342] (1 PDB entry)
  8. 2920672Domain d4uava_: 4uav A: [345446]
    automated match to d4gibb_
    complexed with mg

Details for d4uava_

PDB Entry: 4uav (more details), 1.3 Å

PDB Description: crystal structure of cbby (at3g48420) from arabidobsis thaliana
PDB Compounds: (A:) Haloacid dehalogenase-like hydrolase domain-containing protein At3g48420

SCOPe Domain Sequences for d4uava_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uava_ c.108.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tlpsallfdcdgvlvdtekdghrisfndtfkerdlnvtwdvdlygellkigggkermtay
fnkvgwpekapkdeaerkefiaglhkqktelfmvliekkllplrpgvaklvdqaltngvk
vavcstsnekavsaivscllgperaekikifagdvvpkkkpdpaiynlaaetlgvdpskc
vvvedsaiglaaakaagmtcivtksgytadedfenadavfdcigdppeerfdlafcgsll
rkqfvs

SCOPe Domain Coordinates for d4uava_:

Click to download the PDB-style file with coordinates for d4uava_.
(The format of our PDB-style files is described here.)

Timeline for d4uava_: