Lineage for d4rz9a_ (4rz9 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334647Superfamily a.118.30: Pre-mRNA splicing factor Prp38 N-terminal-like [345917] (1 family) (S)
    Pfam PF03371
    Structural similarity to HEAT repeats, according to PubMed 26673105
    Some loops between helices form beta hairpins
  5. 2334648Family a.118.30.1: Pre-mRNA splicing factor Prp38-like [345958] (1 protein)
  6. 2334649Protein Pre-mRNA splicing factor Prp38A [346044] (2 species)
  7. 2334658Species Human (Homo sapiens) [TaxId:9606] [346208] (4 PDB entries)
  8. 2334659Domain d4rz9a_: 4rz9 A: [345437]

Details for d4rz9a_

PDB Entry: 4rz9 (more details), 1.28 Å

PDB Description: pre-mrna-splicing factor 38a as 1-179
PDB Compounds: (A:) Pre-mRNA-splicing factor 38A

SCOPe Domain Sequences for d4rz9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rz9a_ a.118.30.1 (A:) Pre-mRNA splicing factor Prp38A {Human (Homo sapiens) [TaxId: 9606]}
manrtvkdahsihgtnpqylvekiirtriyeskywkeecfgltaelvvdkamelrfvggv
yggnikptpflcltlkmlqiqpekdiivefiknedfkyvrmlgalymrltgtaidcykyl
eplyndyrkiksqnrngefelmhvdefidellhservcdiilprlqkryvleeaeqlep

SCOPe Domain Coordinates for d4rz9a_:

Click to download the PDB-style file with coordinates for d4rz9a_.
(The format of our PDB-style files is described here.)

Timeline for d4rz9a_:

  • d4rz9a_ is new in SCOPe 2.07-stable